McDonnell Genome Institute

Washington University

Transcript

lnc-TAOK3-8:2

Chromosome

chr12

Gene Name

lnc-TAOK3-8

Start

118375263

CPC Label

noncoding

End

118376866

Cancer

OSCC

Strand

-

Peptide

LSVAHGHR

Modified Peptide

n[145]LSVAHGHR

Peptide Length

8

ORF Length

101

Open Reading Frame (ORF)

LSVAHGHRGHPRSVLAVCLAVSAAAPNSRTGSHGDPFPVSAELRPPRPRSATGASRRERLPGRELPDNGLIPPSLGEWRCRWTPPSPQPQPFHRRLKILNV

Conservation Score

1

PhyloCSF Frame 1

0.987

No. of Spectra

5

CPC Coding Probability

0.0765589

PhyloCSF Frame 2 

0.611

CNTI Index

noncoding

Max Probability

0.9947

PhyloCSF Frame 3

-2.189

CNTI Score

-0.266338935