McDonnell Genome Institute

Washington University

Transcript

lnc-TAOK3-7:1

Chromosome

chr12

Gene Name

lnc-TAOK3-7

Start

118953388

CPC Label

noncoding

End

118956125

Cancer

OV

Strand

-

Peptide

ELLTPGK

Modified Peptide

n[145]ELLTPGK

Peptide Length

7

ORF Length

89

Open Reading Frame (ORF)

LTFKKFSISLQVSHPQLRNNNNGNNNNFIIVIESSLRDRRYAKHFTYVMYQILRKIHEEDINMLQMKTLRLGELKLPKELLTPGKGRRT

Conservation Score

0.978

PhyloCSF Frame 1

-4.874

No. of Spectra

3

CPC Coding Probability

0.0339898

PhyloCSF Frame 2 

-4.634

CNTI Index

noncoding

Max Probability

0.6386

PhyloCSF Frame 3

-1.872

CNTI Score

-0.428555163