McDonnell Genome Institute

Washington University

Transcript

lnc-TAOK1-8:2

Chromosome

chr17

Gene Name

lnc-TAOK1-8

Start

29567547

CPC Label

noncoding

End

29568660

Cancer

OV

Strand

+

Peptide

GLLAPVPASSGLHIK

Modified Peptide

n[145]GLLAPVPASSGLHIK

Peptide Length

15

ORF Length

70

Open Reading Frame (ORF)

LLLPRLHQCGSRGLLAPVPASSGLHIKEILSPGVASPETAAPSLRESVGEKDTLRRPATGMPVRPTRNAS

Conservation Score

0.049

PhyloCSF Frame 1

-0.291

No. of Spectra

13

CPC Coding Probability

0.0325112

PhyloCSF Frame 2 

-3.655

CNTI Index

noncoding

Max Probability

0.9158

PhyloCSF Frame 3

-3.483

CNTI Score

-0.328544289