McDonnell Genome Institute

Washington University

Transcript

lnc-TANK-4:1

Chromosome

chr2

Gene Name

lnc-TANK-4

Start

160952984

CPC Label

noncoding

End

160957296

Cancer

OSCC

Strand

+

Peptide

LGQSLGMAGSVLK

Modified Peptide

n[145]LGQSLGM[147]AGSVLK

Peptide Length

13

ORF Length

69

Open Reading Frame (ORF)

MISLILQRKCWKLQEVCSKGRLGQSLGMAGSVLKRKPVRLELFLWSHTASPSSLWEIKLQFPSSSKTDT

Conservation Score

0.583

PhyloCSF Frame 1

-5.392

No. of Spectra

1

CPC Coding Probability

0.13063

PhyloCSF Frame 2 

-6.368

CNTI Index

noncoding

Max Probability

0.7487

PhyloCSF Frame 3

-5.729

CNTI Score

-0.373590553