McDonnell Genome Institute

Washington University

Transcript

lnc-TANGO6-1:1

Chromosome

chr16

Gene Name

lnc-TANGO6-1

Start

69106253

CPC Label

noncoding

End

69106988

Cancer

OSCC

Strand

+

Peptide

GSGLPSPGRPGGAR

Modified Peptide

n[145]GSGLPSPGRPGGAR

Peptide Length

14

ORF Length

150

Open Reading Frame (ORF)

LLSSGARQPAARLASLLPGGSCFVNELGGGRRCGAPGWLGYPSPAPSTTSRGFAPVRAPRYQAPTFLRVSRAAAARVRGSGLPSPGRPGGARRAAGHKRRSPVGRTSFHAAACGPAAGRTCQRERRCTPAAPQSFGGLMEKRASLTGGSP

Conservation Score

1

PhyloCSF Frame 1

2.995

No. of Spectra

1

CPC Coding Probability

0.0143777

PhyloCSF Frame 2 

-0.859

CNTI Index

noncoding

Max Probability

0.4939

PhyloCSF Frame 3

-0.036

CNTI Score

-0.310211604