McDonnell Genome Institute

Washington University

Transcript

lnc-TAL1-3:2

Chromosome

chr1

Gene Name

lnc-TAL1-3

Start

47204719

CPC Label

noncoding

End

47207228

Cancer

PRAD

Strand

-

Peptide

DLGSLQAPPPGFTPFCCLSLPSSWDYR

Modified Peptide

DLGSLQAPPPGFTPFCCLSLPSSWDYR

Peptide Length

27

ORF Length

80

Open Reading Frame (ORF)

LSTSHMPGPVLFFFFFFFFETESRSVTQAGVQWRDLGSLQAPPPGFTPFCCLSLPSSWDYRRPPPRLANFLYSQVLFLKQ

Conservation Score

0.057

PhyloCSF Frame 1

0

No. of Spectra

7

CPC Coding Probability

0.305576

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9593

PhyloCSF Frame 3

0

CNTI Score

-0.375824302