McDonnell Genome Institute

Washington University

Transcript

lnc-TAF7-6:1

Chromosome

chr5

Gene Name

lnc-TAF7-6

Start

141094653

CPC Label

noncoding

End

141097378

Cancer

OV

Strand

-

Peptide

NPVSVLK

Modified Peptide

n[145]NPVSVLK

Peptide Length

7

ORF Length

49

Open Reading Frame (ORF)

LSPEYLLCMSGWIRNPVSVLKAVLPILHLIETFCECLQMLGKMHKIFLH

Conservation Score

1

PhyloCSF Frame 1

-4.487

No. of Spectra

9

CPC Coding Probability

0.0538038

PhyloCSF Frame 2 

-4.513

CNTI Index

coding

Max Probability

0.9815

PhyloCSF Frame 3

7.466

CNTI Score

0.666376985