McDonnell Genome Institute

Washington University

Transcript

lnc-TAF13-2:1

Chromosome

chr1

Gene Name

lnc-TAF13-2

Start

109087970

CPC Label

noncoding

End

109090858

Cancer

LUAD

Strand

-

Peptide

LHIHTQTNSPAQK

Modified Peptide

LHIHTQTNSPAQK

Peptide Length

13

ORF Length

74

Open Reading Frame (ORF)

LHIHTQTNSPAQKNCSGPLKNKTEQKLYCLGLRILHQPLSKTAAAGRARLTPVIPALWEAEAGGLPEVRSSRPP

Conservation Score

0.178

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.026616

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9958

PhyloCSF Frame 3

0

CNTI Score

-0.330799476