McDonnell Genome Institute

Washington University

Transcript

lnc-TACSTD2-2:3

Chromosome

chr1

Gene Name

lnc-TACSTD2-2

Start

58655473

CPC Label

noncoding

End

58669134

Cancer

BRCA-Basal-like

Strand

-

Peptide

SLGLGDK

Modified Peptide

n[145]SLGLGDK

Peptide Length

7

ORF Length

51

Open Reading Frame (ORF)

MFPYFRENKLYLLSFKKSLGLGDKLRDHPIIVPCVELSCKWHEMDRPCMFP

Conservation Score

1

PhyloCSF Frame 1

-2.185

No. of Spectra

1

CPC Coding Probability

0.0713561

PhyloCSF Frame 2 

-4.681

CNTI Index

noncoding

Max Probability

0.8033

PhyloCSF Frame 3

-4.138

CNTI Score

-0.39045351