McDonnell Genome Institute

Washington University

Transcript

lnc-TACR2-9:1

Chromosome

chr10

Gene Name

lnc-TACR2-9

Start

69088136

CPC Label

noncoding

End

69089052

Cancer

OV

Strand

-

Peptide

EDGWGTR

Modified Peptide

n[145]EDGWGTR

Peptide Length

7

ORF Length

70

Open Reading Frame (ORF)

LHTPQSLIFLGTKLNRTHIKGFSDPKSFFFASFLTILYILCLKMNIMTCMDHRAYREDGWGTRLLSLTLN

Conservation Score

1

PhyloCSF Frame 1

-3.306

No. of Spectra

2

CPC Coding Probability

0.0121903

PhyloCSF Frame 2 

-5.179

CNTI Index

noncoding

Max Probability

0.9416

PhyloCSF Frame 3

1.217

CNTI Score

-0.359968803