McDonnell Genome Institute

Washington University

Transcript

lnc-TACR1-1:4

Chromosome

chr2

Gene Name

lnc-TACR1-1

Start

74911401

CPC Label

noncoding

End

74958879

Cancer

LUAD

Strand

-

Peptide

SLDFPLR

Modified Peptide

n[230]SLDFPLR

Peptide Length

7

ORF Length

114

Open Reading Frame (ORF)

LIVSLLSGTSRSSRTSGPFSAPDCGSANLANGVQAHGRGARVTVAPGLAQNKSLDFPLRTCTSFSFPHVCRWQLHSFMEWRPKTLESALSLFPSHIYPFYQEIYWFHLQNTPRP

Conservation Score

0.63

PhyloCSF Frame 1

-4.502

No. of Spectra

1

CPC Coding Probability

0.213692

PhyloCSF Frame 2 

-3.549

CNTI Index

noncoding

Max Probability

0.9974

PhyloCSF Frame 3

-3.683

CNTI Score

-0.274683383