McDonnell Genome Institute

Washington University

Transcript

lnc-TACR1-1:2

Chromosome

chr2

Gene Name

lnc-TACR1-1

Start

74918694

CPC Label

noncoding

End

74940575

Cancer

PRAD

Strand

-

Peptide

AQATEPSDNSIDANLR

Modified Peptide

‚Äč

Peptide Length

16

ORF Length

174

Open Reading Frame (ORF)

LTISSPVPRIHPAPDYHPKAVHRHHSGDSISHNGTSQQEQSNCQAALLHRAQATEPSDNSIDANLRVPQGNRSTLHMEWRFRKAPKRKKTRISVHVCPCMGLPFVLTTLGSAIAEPALLEEDSQITSLVFFCHLLCCPSFPPGDPHFVLGSTLPLITLGLRHKISHCWESIFSL

Conservation Score

0.872

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.0852147

PhyloCSF Frame 2 

-4.014

CNTI Index

noncoding

Max Probability

0.6734

PhyloCSF Frame 3

-4.975

CNTI Score

-0.295541587