McDonnell Genome Institute

Washington University

Transcript

lnc-TACC3-4:2

Chromosome

chr4

Gene Name

lnc-TACC3-4

Start

1559840

CPC Label

noncoding

End

1562024

Cancer

OV

Strand

+

Peptide

GLFCAMAAELQR

Modified Peptide

n[145]GLFCAMAAELQR

Peptide Length

12

ORF Length

44

Open Reading Frame (ORF)

LVWEAQPGSSWPRAGGQRGLFCAMAAELQRWGGRRGDPGSREAA

Conservation Score

0.083

PhyloCSF Frame 1

-5.221

No. of Spectra

36

CPC Coding Probability

0.107662

PhyloCSF Frame 2 

-2.624

CNTI Index

noncoding

Max Probability

0.906

PhyloCSF Frame 3

-4.92

CNTI Score

-0.314190759