McDonnell Genome Institute

Washington University

Transcript

lnc-TAAR9-3:1

Chromosome

chr6

Gene Name

lnc-TAAR9-3

Start

132401594

CPC Label

noncoding

End

132402939

Cancer

OV

Strand

+

Peptide

DTGIFDHVWK

Modified Peptide

n[145]DTGIFDHVWK

Peptide Length

10

ORF Length

65

Open Reading Frame (ORF)

LPSAEKDTGIFDHVWKVTCRWICLPKCSGTCLGRDFSQGEIGSRSAGLANGNRPASEKSDVGTAK

Conservation Score

0.566

PhyloCSF Frame 1

-5.856

No. of Spectra

1

CPC Coding Probability

0.00826669

PhyloCSF Frame 2 

-4.605

CNTI Index

noncoding

Max Probability

0.8278

PhyloCSF Frame 3

-3.883

CNTI Score

-0.320039748