McDonnell Genome Institute

Washington University

Transcript

lnc-SYTL3-2:3

Chromosome

chr6

Gene Name

lnc-SYTL3-2

Start

158870139

CPC Label

coding

End

158919105

Cancer

EOGC

Strand

+

Peptide

FLASSDPPVSVPEMLGLQVER

Modified Peptide

n[145]FLASSDPPVSVPEMLGLQVER

Peptide Length

21

ORF Length

67

Open Reading Frame (ORF)

MLPILVSKFLASSDPPVSVPEMLGLQVERYEERGTLPGEFLPLQNKGVCTELPFPAPTSRISALPAE

Conservation Score

0.898

PhyloCSF Frame 1

0

No. of Spectra

9

CPC Coding Probability

0.985852

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8521

PhyloCSF Frame 3

0

CNTI Score

-0.386065873