McDonnell Genome Institute

Washington University

Transcript

lnc-SYT8-3:1

Chromosome

chr11

Gene Name

lnc-SYT8-3

Start

1792552

CPC Label

noncoding

End

1792870

Cancer

BRCA-Luminal B

Strand

+

Peptide

IVLGLECIQPNCR

Modified Peptide

n[145]IVLGLECIQPNCR

Peptide Length

13

ORF Length

106

Open Reading Frame (ORF)

MVKVPKTRRTFCKKCDKHQPHKVRQYKDGKDSLYAQGKWRYDRKQSGYGGQTKPIFRKKAKTTKKIVLGLECIQPNCRSKRMLATERCKHFELGGDKKRKGQMIQF

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.161012

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9519

PhyloCSF Frame 3

0

CNTI Score

-0.324263426