McDonnell Genome Institute

Washington University

Transcript

lnc-SYT16-67:16

Chromosome

chr14

Gene Name

lnc-SYT16-67

Start

62127243

CPC Label

noncoding

End

62128537

Cancer

BRCA-HER2-enriched

Strand

+

Peptide

FGCVLTLNGMK

Modified Peptide

n[145]FGCVLTLNGMK

Peptide Length

11

ORF Length

54

Open Reading Frame (ORF)

LGCQLFYASLINLVTLNDLSVLGSLTKRMMKNFFSPPITFHFKFGCVLTLNGMK

Conservation Score

0.408

PhyloCSF Frame 1

-4.915

No. of Spectra

1

CPC Coding Probability

0.0545272

PhyloCSF Frame 2 

-4.36

CNTI Index

coding

Max Probability

0.9972

PhyloCSF Frame 3

-5.129

CNTI Score

0.590155043