McDonnell Genome Institute

Washington University

Transcript

lnc-SYT13-8:1

Chromosome

chr11

Gene Name

lnc-SYT13-8

Start

44929351

CPC Label

noncoding

End

44930992

Cancer

OV

Strand

-

Peptide

ETQMILGISSTLGAGELGK

Modified Peptide

n[145]ETQM[147]ILGISSTLGAGELGK

Peptide Length

19

ORF Length

40

Open Reading Frame (ORF)

LGVERETQMILGISSTLGAGELGKDQGCMWAAELTESWMQ

Conservation Score

0.962

PhyloCSF Frame 1

-5.862

No. of Spectra

3

CPC Coding Probability

0.0840833

PhyloCSF Frame 2 

-3.524

CNTI Index

noncoding

Max Probability

0.8709

PhyloCSF Frame 3

-3.199

CNTI Score

-0.331553587