McDonnell Genome Institute

Washington University

Transcript

lnc-SYT10-4:1

Chromosome

chr12

Gene Name

lnc-SYT10-4

Start

34208414

CPC Label

coding

End

34209675

Cancer

OV

Strand

-

Peptide

GGAGARGPMSPGPRGNLK

Modified Peptide

n[145]GGAGARGPM[147]SPGPRGNLK

Peptide Length

18

ORF Length

156

Open Reading Frame (ORF)

LPCSSPARLRRQKESPNWSWHSGILPTLPWLIQKRRPPTLRFLGGLRTPTNARRTRTHRTAACWVLAQWDSLNLLKLSPKGEVCLRHTHPTRVRGGAGARGPMSPGPRGNLKLGHLHLQSPRLRKPPRHRSRCKPSRRPPNRSRSRSACLQSPLAC

Conservation Score

0.146

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.551129

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.3724

PhyloCSF Frame 3

0

CNTI Score

-0.263609039