McDonnell Genome Institute

Washington University

Transcript

lnc-SYT10-3:5

Chromosome

chr12

Gene Name

lnc-SYT10-3

Start

34191036

CPC Label

noncoding

End

34219726

Cancer

EOGC

Strand

-

Peptide

SQSLPFCLSSSLRSPGQPADGGGTAGR

Modified Peptide

n[145]SQSLPFCLSSSLRSPGQPADGGGTAGR

Peptide Length

27

ORF Length

130

Open Reading Frame (ORF)

LRRGCQRVCPCGSCPSSVHACPVVATGVTAPLPAPGAREWDRSQSLPFCLSSSLRSPGQPADGGGTAGRSAELDGRKVFLCCPGWSAVVRSRGKTWPAGVLPQTTVPSRQHLRRAQEGRGVAGFLPGTQS

Conservation Score

0.261

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.12625

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.0642

PhyloCSF Frame 3

0

CNTI Score

-0.326613419