McDonnell Genome Institute

Washington University

Transcript

lnc-SYT10-3:2

Chromosome

chr12

Gene Name

lnc-SYT10-3

Start

34191036

CPC Label

noncoding

End

34218853

Cancer

OV

Strand

-

Peptide

LSIYCMSHYMK

Modified Peptide

n[145]LSIYCM[147]SHYM[147]K

Peptide Length

11

ORF Length

43

Open Reading Frame (ORF)

LSIYCMSHYMKLQGILYYIFNHVSLVPSTVLPYSLLLNICRMK

Conservation Score

0.097

PhyloCSF Frame 1

0

No. of Spectra

14

CPC Coding Probability

0.0133552

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7955

PhyloCSF Frame 3

0

CNTI Score

-0.390050294