McDonnell Genome Institute

Washington University

Transcript

lnc-SYPL2-1:1

Chromosome

chr1

Gene Name

lnc-SYPL2-1

Start

109422500

CPC Label

noncoding

End

109425540

Cancer

HCC

Strand

+

Peptide

LGSSSYPASASPAAK

Modified Peptide

n[43]LGSSSYPASASPAAK

Peptide Length

15

ORF Length

48

Open Reading Frame (ORF)

LGSSSYPASASPAAKTTGACHHARLIFVFLVEMGFHHIGQAGLELLTS

Conservation Score

0.08

PhyloCSF Frame 1

0

No. of Spectra

14

CPC Coding Probability

0.0739503

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9969

PhyloCSF Frame 3

0

CNTI Score

-0.367630178