McDonnell Genome Institute

Washington University

Transcript

lnc-SYNJ2BP-2:1

Chromosome

chr14

Gene Name

lnc-SYNJ2BP-2

Start

70362507

CPC Label

noncoding

End

70391716

Cancer

OV

Strand

-

Peptide

SPEATVAFDEGVGFHQK

Modified Peptide

n[145]SPEATVAFDEGVGFHQK

Peptide Length

17

ORF Length

60

Open Reading Frame (ORF)

LLNICFLFPRSPEATVAFDEGVGFHQKIFLHSLFQLGRGGLALAPLFKAVTVLKSFQNLR

Conservation Score

0.985

PhyloCSF Frame 1

-4.369

No. of Spectra

1

CPC Coding Probability

0.0202762

PhyloCSF Frame 2 

-5.457

CNTI Index

noncoding

Max Probability

0.8013

PhyloCSF Frame 3

-3.856

CNTI Score

-0.375689608