McDonnell Genome Institute

Washington University

Transcript

lnc-SYNE3-3:5

Chromosome

chr14

Gene Name

lnc-SYNE3-3

Start

95521969

CPC Label

noncoding

End

95524521

Cancer

OV

Strand

-

Peptide

MWRQEEVRWLASAQPTGK

Modified Peptide

n[145]M[147]WRQEEVRWLASAQPTGK

Peptide Length

18

ORF Length

53

Open Reading Frame (ORF)

MWRQEEVRWLASAQPTGKCRAQRDSKSGDVDPGSFSLCHPPHRWKHRHYQGCI

Conservation Score

0.979

PhyloCSF Frame 1

-3.493

No. of Spectra

1

CPC Coding Probability

0.270984

PhyloCSF Frame 2 

-3.151

CNTI Index

noncoding

Max Probability

0.3646

PhyloCSF Frame 3

-4.099

CNTI Score

-0.373872485