McDonnell Genome Institute

Washington University

Transcript

lnc-SYNE2-3:7

Chromosome

chr14

Gene Name

lnc-SYNE2-3

Start

63642060

CPC Label

noncoding

End

63665857

Cancer

PRAD

Strand

+

Peptide

QFFCLSLLSGWDYR

Modified Peptide

QFFCLSLLSGWDYR

Peptide Length

14

ORF Length

68

Open Reading Frame (ORF)

LQPPPPGFKQFFCLSLLSGWDYRQVPPGTANFCIFSRDAVLPCWPGWSRSLDLVICLPRPPKVLGLQV

Conservation Score

0.311

PhyloCSF Frame 1

0

No. of Spectra

10

CPC Coding Probability

0.159764

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9961

PhyloCSF Frame 3

0

CNTI Score

-0.277262128