McDonnell Genome Institute

Washington University

Transcript

lnc-SYNE2-3:5

Chromosome

chr14

Gene Name

lnc-SYNE2-3

Start

63642060

CPC Label

noncoding

End

63665857

Cancer

OV

Strand

+

Peptide

LSNIARPSLKK

Modified Peptide

n[145]LSNIARPSLKK

Peptide Length

11

ORF Length

42

Open Reading Frame (ORF)

LSNIARPSLKKKKLYVILLASSHAQSLYQGSIRKIKSIGDIY

Conservation Score

0.016

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.159764

PhyloCSF Frame 2 

-5.008

CNTI Index

noncoding

Max Probability

0.9971

PhyloCSF Frame 3

0

CNTI Score

-0.277262128