McDonnell Genome Institute

Washington University

Transcript

lnc-SYNDIG1-6:1

Chromosome

chr20

Gene Name

lnc-SYNDIG1-6

Start

24147766

CPC Label

noncoding

End

24172588

Cancer

OV

Strand

+

Peptide

LLIIQVDSGK

Modified Peptide

n[145]LLIIQVDSGK

Peptide Length

10

ORF Length

74

Open Reading Frame (ORF)

LLIIQVDSGKIGPLLIRQVLLSILCHARHNPLHGLLPVRQPVALGLIQGSWVLSRPDPNTCRVQTKSTNGNPHA

Conservation Score

0.16

PhyloCSF Frame 1

-4.484

No. of Spectra

13

CPC Coding Probability

0.0668986

PhyloCSF Frame 2 

-5.523

CNTI Index

noncoding

Max Probability

0.846

PhyloCSF Frame 3

-4.484

CNTI Score

-0.353819106