McDonnell Genome Institute

Washington University

Transcript

lnc-SYN3-2:1

Chromosome

chr22

Gene Name

lnc-SYN3-2

Start

33105382

CPC Label

noncoding

End

33106059

Cancer

OV

Strand

-

Peptide

LAYILILQLR

Modified Peptide

n[145]LAYILILQLR

Peptide Length

10

ORF Length

41

Open Reading Frame (ORF)

LAYILILQLRKGRLSAAPGNKQLRRNGMFLTRSSRAVIAPL

Conservation Score

1

PhyloCSF Frame 1

-2.935

No. of Spectra

12

CPC Coding Probability

0.0257763

PhyloCSF Frame 2 

-5.094

CNTI Index

noncoding

Max Probability

0.9658

PhyloCSF Frame 3

-3.265

CNTI Score

-0.355311496