McDonnell Genome Institute

Washington University

Transcript

lnc-SYN2-6:1

Chromosome

chr3

Gene Name

lnc-SYN2-6

Start

11906526

CPC Label

noncoding

End

11912313

Cancer

HCC

Strand

+

Peptide

LDTIGCGTFSEVK

Modified Peptide

n[230]LDTIGCGTFSEVK

Peptide Length

13

ORF Length

38

Open Reading Frame (ORF)

LDTIGCGTFSEVKLTPHVLTGTQVAIEIIPKNFTQRET

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.024276

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9096

PhyloCSF Frame 3

0

CNTI Score

-0.31635586