McDonnell Genome Institute

Washington University

Transcript

lnc-SYN2-5:1

Chromosome

chr3

Gene Name

lnc-SYN2-5

Start

11900010

CPC Label

noncoding

End

11901245

Cancer

OV

Strand

+

Peptide

LNLEDSPLELK

Modified Peptide

n[145]LNLEDSPLELK

Peptide Length

11

ORF Length

92

Open Reading Frame (ORF)

LSTRPEVASIESLGLDEQQCSQKAVVQAHLTQPARLTSIIFAEDISKGTDQVLHCDATVDLIPGIQIVSTTRKLNLEDSPLELKIQALDSEG

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

7

CPC Coding Probability

0.0060091

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9997

PhyloCSF Frame 3

0

CNTI Score

0.746949026