McDonnell Genome Institute

Washington University

Transcript

lnc-SYK-6:8

Chromosome

chr9

Gene Name

lnc-SYK-6

Start

91424032

CPC Label

noncoding

End

91430449

Cancer

OV

Strand

+

Peptide

SVEDFVSPHTGR

Modified Peptide

n[145]SVEDFVSPHTGR

Peptide Length

12

ORF Length

113

Open Reading Frame (ORF)

LLSCPPTFVTPETKVVFWSRLFQQEIKVNALRLVNALKKSGNWVLDRISGLLRNFQKCSRFRCHCVFSCCCVMLLSGGACRSVEDFVSPHTGRMIKEPALGQSPGIAGSRAQC

Conservation Score

1

PhyloCSF Frame 1

-4.096

No. of Spectra

1

CPC Coding Probability

0.266117

PhyloCSF Frame 2 

-4.507

CNTI Index

noncoding

Max Probability

0.8025

PhyloCSF Frame 3

-4.335

CNTI Score

-0.282737801