McDonnell Genome Institute

Washington University

Transcript

lnc-SYK-6:7

Chromosome

chr9

Gene Name

lnc-SYK-6

Start

91424032

CPC Label

noncoding

End

91427598

Cancer

OSCC

Strand

+

Peptide

LGSSTLSVLCIGLMDFFVEK

Modified Peptide

n[145]LGSSTLSVLCIGLM[147]DFFVEK

Peptide Length

20

ORF Length

117

Open Reading Frame (ORF)

LQDLPTQRLDSLSPLSSTEMSWEQGVETGDSVAKKQAAYLATKLGSSTLSVLCIGLMDFFVEKTSITKSPLVTSCLVWWPAACIRAPVCQDHFLSTVVCLWTTLCLFIKLQEQKFSF

Conservation Score

0.834

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.104726

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.1353

PhyloCSF Frame 3

0

CNTI Score

-0.282737801