McDonnell Genome Institute

Washington University

Transcript

lnc-SYK-12:1

Chromosome

chr9

Gene Name

lnc-SYK-12

Start

91611342

CPC Label

noncoding

End

91612492

Cancer

EOGC

Strand

+

Peptide

NPGVIDR

Modified Peptide

n[145]NPGVIDR

Peptide Length

7

ORF Length

81

Open Reading Frame (ORF)

LYNIFQSLQEASIKAAFTKKCGDMAFIVPQCEIIPVKGVCRIATCCFLKRNPGVIDRCEFYSPNVEMFSRVLPVMRNSELL

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0329691

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9993

PhyloCSF Frame 3

0

CNTI Score

-0.365810944