McDonnell Genome Institute

Washington University

Transcript

lnc-SYF2-1:3

Chromosome

chr1

Gene Name

lnc-SYF2-1

Start

25262579

CPC Label

noncoding

End

25266899

Cancer

EOGC

Strand

-

Peptide

LSSFSLTFVMVNFR

Modified Peptide

n[145]LSSFSLTFVMVNFR

Peptide Length

14

ORF Length

40

Open Reading Frame (ORF)

LHSSLPYKLSSFSLTFVMVNFRCQLDWIKEYLENWKGIIC

Conservation Score

0.536

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.298918

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9976

PhyloCSF Frame 3

0

CNTI Score

-0.321756358