McDonnell Genome Institute

Washington University

Transcript

lnc-SYCP2-4:1

Chromosome

chr20

Gene Name

lnc-SYCP2-4

Start

59514659

CPC Label

noncoding

End

59521395

Cancer

CCRC

Strand

-

Peptide

LSLGSVLK

Modified Peptide

n[230]LSLGSVLK

Peptide Length

8

ORF Length

116

Open Reading Frame (ORF)

LSLGSVLKHLCVSFSGTPCPELALASITPVFPGRQALECKITSRCLGAREQKGSLRCHSNPLQCNLEGHESSQGLWGERLEVAWCCCVMSVREGSDAPGAEVSGAAGQCPGQSSGG

Conservation Score

0.056

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0545738

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9983

PhyloCSF Frame 3

2.007

CNTI Score

-0.340413817