McDonnell Genome Institute

Washington University

Transcript

lnc-SYCP2-2:1

Chromosome

chr20

Gene Name

lnc-SYCP2-2

Start

59467878

CPC Label

coding

End

59469835

Cancer

OV

Strand

-

Peptide

VMVSSLLSFPSPGALGR

Modified Peptide

n[145]VM[147]VSSLLSFPSPGALGR

Peptide Length

17

ORF Length

84

Open Reading Frame (ORF)

LLKVMVSSLLSFPSPGALGRDPREIHALSCACLSASPQANCCSAKEGPALCLCAPIARVSCSAVKGSLDCSRVWNLGTLQAESL

Conservation Score

0.159

PhyloCSF Frame 1

-4.113

No. of Spectra

5

CPC Coding Probability

0.54736

PhyloCSF Frame 2 

-4.264

CNTI Index

noncoding

Max Probability

0.9229

PhyloCSF Frame 3

-3.285

CNTI Score

-0.341930818