McDonnell Genome Institute

Washington University

Transcript

lnc-SYCP1-4:1

Chromosome

chr1

Gene Name

lnc-SYCP1-4

Start

114511274

CPC Label

noncoding

End

114515935

Cancer

OSCC

Strand

+

Peptide

VVAGTVPVPASVSR

Modified Peptide

n[145]VVAGTVPVPASVSR

Peptide Length

14

ORF Length

66

Open Reading Frame (ORF)

LAGVGYELRHSGGAYGRVVAGTVPVPASVSRASPRKFHLPRRSIAGTSWVSAVRRPAAFLWVAVEH

Conservation Score

0.077

PhyloCSF Frame 1

1.469

No. of Spectra

10

CPC Coding Probability

0.0336317

PhyloCSF Frame 2 

-3.476

CNTI Index

noncoding

Max Probability

0.7457

PhyloCSF Frame 3

-2.294

CNTI Score

-0.326434096