McDonnell Genome Institute

Washington University

Transcript

lnc-SYCE1-1:2

Chromosome

chr10

Gene Name

lnc-SYCE1-1

Start

133566718

CPC Label

coding

End

133569958

Cancer

OV

Strand

-

Peptide

VAAAGAAGSGWRR

Modified Peptide

n[145]VAAAGAAGSGWRR

Peptide Length

13

ORF Length

124

Open Reading Frame (ORF)

MAGLCYRRQPSSACGRGGLRGGSRGASRVCVRPALCYGAPGSSLRVAAAGAAGSGWRRAAGPGERGLEDEEDWVPGGNRTGSASTATVRGLRALDPRAACASVSGWVAPSVPWGCCGPRPGWAR

Conservation Score

0.3

PhyloCSF Frame 1

0

No. of Spectra

11

CPC Coding Probability

0.883601

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9484

PhyloCSF Frame 3

0

CNTI Score

0.70958845