McDonnell Genome Institute

Washington University

Transcript

lnc-SUZ12-8:1

Chromosome

chr17

Gene Name

lnc-SUZ12-8

Start

31759794

CPC Label

noncoding

End

31761385

Cancer

OV

Strand

+

Peptide

LLIDIIHNLLVR

Modified Peptide

n[145]LLIDIIHNLLVR

Peptide Length

12

ORF Length

59

Open Reading Frame (ORF)

LHTRPHSALIPRLSLPSSWDYRWEPRSPASMSFISQHYKLLIDIIHNLLVRTCHISTGN

Conservation Score

0.901

PhyloCSF Frame 1

0

No. of Spectra

10

CPC Coding Probability

0.126154

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9591

PhyloCSF Frame 3

0

CNTI Score

-0.365859171