McDonnell Genome Institute

Washington University

Transcript

lnc-SUSD4-1:1

Chromosome

chr1

Gene Name

lnc-SUSD4-1

Start

223391166

CPC Label

noncoding

End

223393230

Cancer

OV

Strand

-

Peptide

RAGVQSQGGGTLSCR

Modified Peptide

n[145]RAGVQSQGGGTLSCR

Peptide Length

15

ORF Length

49

Open Reading Frame (ORF)

MEGVGRRAGVQSQGGGTLSCRITVLHVCTSAMWSNRTAVDATPPICLLS

Conservation Score

0.055

PhyloCSF Frame 1

-2.961

No. of Spectra

2

CPC Coding Probability

0.0601813

PhyloCSF Frame 2 

-3.993

CNTI Index

noncoding

Max Probability

0.8307

PhyloCSF Frame 3

-3.596

CNTI Score

-0.395742449