McDonnell Genome Institute

Washington University

Transcript

lnc-SUPT16H-3:2

Chromosome

chr14

Gene Name

lnc-SUPT16H-3

Start

21262992

CPC Label

noncoding

End

21269389

Cancer

OV

Strand

-

Peptide

ESEGISIFK

Modified Peptide

n[145]ESEGISIFK

Peptide Length

9

ORF Length

49

Open Reading Frame (ORF)

LNVSKNFSGLLIDFGVLHLGRESEGISIFKWFDHVNLFSPNPTLALIPF

Conservation Score

1

PhyloCSF Frame 1

-1.737

No. of Spectra

4

CPC Coding Probability

0.0132107

PhyloCSF Frame 2 

-2.82

CNTI Index

noncoding

Max Probability

0.9953

PhyloCSF Frame 3

-3.396

CNTI Score

-0.38479427