McDonnell Genome Institute

Washington University

Transcript

lnc-SUMO4-5:4

Chromosome

chr6

Gene Name

lnc-SUMO4-5

Start

149259693

CPC Label

noncoding

End

149271852

Cancer

EOGC

Strand

+

Peptide

VYVGDHIAVQHR

Modified Peptide

n[145]VYVGDHIAVQHR

Peptide Length

12

ORF Length

93

Open Reading Frame (ORF)

LTHRVLQRSLLRVRLWSGECGTRPYRAFAQLKIKRSWLLSAITPYTYTASCSENLKMNYLAGQSCALLKTLLYGRVYVGDHIAVQHREEMEVW

Conservation Score

0.785

PhyloCSF Frame 1

-5.382

No. of Spectra

193

CPC Coding Probability

0.0183014

PhyloCSF Frame 2 

-4.489

CNTI Index

noncoding

Max Probability

0.9984

PhyloCSF Frame 3

-4.584

CNTI Score

-0.388920732