McDonnell Genome Institute

Washington University

Transcript

lnc-SUMO4-2:1

Chromosome

chr6

Gene Name

lnc-SUMO4-2

Start

149383832

CPC Label

noncoding

End

149385871

Cancer

CCRC

Strand

+

Peptide

MSELEETLKGMK

Modified Peptide

n[272]MSELEETLKGMK

Peptide Length

12

ORF Length

45

Open Reading Frame (ORF)

MSELEETLKGMKNSTPKVIQSTYPSSLSSVNPFCTLNSYETQTAS

Conservation Score

0.205

PhyloCSF Frame 1

-5.35

No. of Spectra

1

CPC Coding Probability

0.023682

PhyloCSF Frame 2 

-4.64

CNTI Index

noncoding

Max Probability

0.0733

PhyloCSF Frame 3

-2.992

CNTI Score

-0.424546333