McDonnell Genome Institute

Washington University

Transcript

lnc-SUMO1-5:1

Chromosome

chr2

Gene Name

lnc-SUMO1-5

Start

202329638

CPC Label

noncoding

End

202337804

Cancer

BRCA-Luminal B

Strand

-

Peptide

NSWLVESMDTKPIHR

Modified Peptide

n[145]NSWLVESM[147]DTKPIHR

Peptide Length

15

ORF Length

46

Open Reading Frame (ORF)

LPGQYSETPFSTKKKKTKQKNSWLVESMDTKPIHRYRELTINMSSG

Conservation Score

0.113

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.014098

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9981

PhyloCSF Frame 3

0

CNTI Score

-0.383889159