McDonnell Genome Institute

Washington University

Transcript

lnc-SUMO1-2:1

Chromosome

chr2

Gene Name

lnc-SUMO1-2

Start

202113625

CPC Label

noncoding

End

202117058

Cancer

OV

Strand

-

Peptide

AVFSLGK

Modified Peptide

n[145]AVFSLGK

Peptide Length

7

ORF Length

66

Open Reading Frame (ORF)

LDYQLAVSTSAGWLERREKAVFSLGKYQKDFIILIKASAWHIRPLPSHSTGTSLSKCSSKSKLVMQ

Conservation Score

1

PhyloCSF Frame 1

-3.88

No. of Spectra

1

CPC Coding Probability

0.0577161

PhyloCSF Frame 2 

-4.233

CNTI Index

noncoding

Max Probability

0.4586

PhyloCSF Frame 3

-2.65

CNTI Score

-0.392394325