McDonnell Genome Institute

Washington University

Transcript

lnc-SUMF2-16:1

Chromosome

chr7

Gene Name

lnc-SUMF2-16

Start

56576244

CPC Label

coding

End

56598089

Cancer

BRCA-HER2-enriched

Strand

+

Peptide

FAGASINIAPAEAPDAK

Modified Peptide

n[145]FAGASINIAPAEAPDAK

Peptide Length

17

ORF Length

95

Open Reading Frame (ORF)

LSNQKRRLFICLSRLYQSVSSSASRAKHIKQLSRFAGASINIAPAEAPDAKVRMVMITGPPEAHFKAQGRIYGKTKEENFVSPKEEVKLEAYITV

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.879721

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.0693

PhyloCSF Frame 3

0

CNTI Score

-0.309284644