McDonnell Genome Institute

Washington University

Transcript

lnc-SUMF1-5:6

Chromosome

chr3

Gene Name

lnc-SUMF1-5

Start

5180837

CPC Label

noncoding

End

5187338

Cancer

OV

Strand

-

Peptide

NPQKPSNTAVIK

Modified Peptide

n[145]NPQKPSNTAVIK

Peptide Length

12

ORF Length

35

Open Reading Frame (ORF)

MAPLHSSLGNRVRLHLKTNKQKNPQKPSNTAVIKD

Conservation Score

0.267

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0274124

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8375

PhyloCSF Frame 3

0

CNTI Score

-0.325976087