McDonnell Genome Institute

Washington University

Transcript

lnc-SUMF1-5:2

Chromosome

chr3

Gene Name

lnc-SUMF1-5

Start

5137628

CPC Label

coding

End

5187338

Cancer

BRCA-Luminal B

Strand

-

Peptide

ISEQTVEEGSAHK

Modified Peptide

n[145]ISEQTVEEGSAHK

Peptide Length

13

ORF Length

49

Open Reading Frame (ORF)

MISEQTVEEGSAHKRKESFVIGKSKLKWGRGRGYNLLRVIIKLTHLGRL

Conservation Score

0.072

PhyloCSF Frame 1

0

No. of Spectra

14

CPC Coding Probability

0.832983

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9977

PhyloCSF Frame 3

0

CNTI Score

-0.326856421