McDonnell Genome Institute

Washington University

Transcript

lnc-SUMF1-4:1

Chromosome

chr3

Gene Name

lnc-SUMF1-4

Start

4956525

CPC Label

noncoding

End

4980374

Cancer

LUAD

Strand

-

Peptide

YILHHVSIHTR

Modified Peptide

n[230]YILHHVSIHTR

Peptide Length

11

ORF Length

160

Open Reading Frame (ORF)

LPGRVVWVVHRSTPGGAIHIAVCVRAPSGVVQCGTEQLHWVILPFCSRPCCFVSSKWGENIISYKRKMGSFSSFLLGLSILVALHCVLNESILLLSIVTPGPFLCKNLEPQAPLYIPTTCLLRYHFLPAYEASKIFISAHGKKYILHHVSIHTRMSLHTS

Conservation Score

0.999

PhyloCSF Frame 1

-5.339

No. of Spectra

49

CPC Coding Probability

0.202831

PhyloCSF Frame 2 

-4.552

CNTI Index

coding

Max Probability

0.9974

PhyloCSF Frame 3

-4.856

CNTI Score

0.710425836