McDonnell Genome Institute

Washington University

Transcript

lnc-SUMF1-2:2

Chromosome

chr3

Gene Name

lnc-SUMF1-2

Start

3700813

CPC Label

noncoding

End

3800875

Cancer

OV

Strand

-

Peptide

DYPCLDSPPPQPQEATSYQR

Modified Peptide

n[145]DYPCLDSPPPQPQEATSYQR

Peptide Length

20

ORF Length

115

Open Reading Frame (ORF)

LASLLFNLKTAYRETLPRDYPCLDSPPPQPQEATSYQRQNLHNRTKEGYKLLEGRDYISFNLLSQVSTAKPSKRRSEHLMAELEEVKENPRDTLDMFCIIWIQTGLNLSKEINMI

Conservation Score

0.211

PhyloCSF Frame 1

0

No. of Spectra

7

CPC Coding Probability

0.0230348

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7085

PhyloCSF Frame 3

0

CNTI Score

-0.329586282